Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small EDRK-rich factor 2 (SERF2), transcript variant 3 (NM_001018108). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P84101 |
| Entry Name | SERF2_HUMAN |
| Gene Names | SERF2 FAM2C |
| Alternative Gene Names | FAM2C |
| Alternative Protein Names | Small EDRK-rich factor 2 (Gastric cancer-related protein VRG107) (Protein 4F5-related) (4F5rel) (h4F5rel) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 59 |
| Molecular Weight(Da) | 6900 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK |
Background
| Function | FUNCTION: Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760). {ECO:0000269|PubMed:20723760}. |
| Pathway | |
| Protein Families | SERF family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |