Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens small EDRK-rich factor 1A (SERF1A), transcript variant 2 (NM_022968). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O75920 |
| Entry Name | SERF1_HUMAN |
| Gene Names | SERF1A FAM2A SERF1 SMAM1; SERF1B FAM2B SERF1 SMAM1 |
| Alternative Gene Names | FAM2A SERF1 SMAM1; FAM2B SERF1 SMAM1 |
| Alternative Protein Names | Small EDRK-rich factor 1 (Protein 4F5) (h4F5) (SMA modifier 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 110 |
| Molecular Weight(Da) | 12349 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI |
Background
| Function | FUNCTION: Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760, PubMed:22854022, PubMed:31034892). Induces conformational changes in amyloid proteins, such as APP, HTT, and SNCA, driving them into compact formations preceding the formation of aggregates (PubMed:20723760, PubMed:22854022, PubMed:31034892). {ECO:0000269|PubMed:20723760, ECO:0000269|PubMed:22854022, ECO:0000269|PubMed:31034892}. |
| Pathway | |
| Protein Families | SERF family |
| Tissue Specificity | Isoform Long is predominantly expressed in heart, brain and skeletal muscle. Isoform Short and Isoform Long are expressed throughout the central nervous system, including spinal cord. {ECO:0000269|PubMed:9731538}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |