Recombinant Human SENP8 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens SUMO peptidase family member, NEDD8 specific (SENP8), transcript variant 2 (NM_145204).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96LD8
Entry Name SENP8_HUMAN
Gene Names SENP8 DEN1 NEDP1 PRSC2 FKSG8
Alternative Gene Names DEN1 NEDP1 PRSC2
Alternative Protein Names Sentrin-specific protease 8 (EC 3.4.22.-) (Deneddylase-1) (NEDD8-specific protease 1) (Protease, cysteine 2) (Sentrin/SUMO-specific protease SENP8)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 212
Molecular Weight(Da) 24107
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Background
Function FUNCTION: Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53. {ECO:0000269|PubMed:12730221, ECO:0000269|PubMed:12759362, ECO:0000269|PubMed:12759363, ECO:0000269|PubMed:15242646, ECO:0000269|PubMed:15775960}.
Pathway
Protein Families Peptidase C48 family
Tissue Specificity Broadly expressed, with highest levels in kidney and pancreas. {ECO:0000269|PubMed:12730221}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8013237

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SENP8 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.