Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q8WWX9 |
Gene Names | SELM |
Alternative Names | SELENOM; SELM; Selenoprotein M; SelM |
Expression Region | Full Length of Mature Protein(24-145aa ) |
Molecular Weight | 13.9 kDa |
Protein Sequence | ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, perinuclear region, Endoplasmic reticulum, Golgi apparatus |
Protein Families | Selenoprotein M/F family |
Tissue Specificity | SELM |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |