Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O14828 |
Gene Names | SCAMP3 |
Alternative Names | C1orf3; Propin 1; Propin1; Sc3; SCAM3_HUMAN; SCAMP 3; SCAMP3; Secretory carrier associated membrane protein 3; Secretory carrier membrane protein 3; Secretory carrier-associated membrane protein 3; TU52 |
Expression Region | Partial(2-170aa ) |
Molecular Weight | 45.9 kDa |
Protein Sequence | AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface. |
Involvement in Disease | |
Subcellular Location | Membrane, Multi-pass membrane protein |
Protein Families | SCAMP family |
Tissue Specificity | SCAMP3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |