Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens SLP adaptor and CSK interacting membrane protein (SCIMP), transcript variant 1 (NM_207103). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q6UWF3 |
| Entry Name | SCIMP_HUMAN |
| Gene Names | SCIMP C17orf87 UNQ5783/PRO16090 |
| Alternative Gene Names | C17orf87 |
| Alternative Protein Names | SLP adapter and CSK-interacting membrane protein (SLP65/SLP76, Csk-interacting membrane protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 145 |
| Molecular Weight(Da) | 16618 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTEKASF |
Background
| Function | FUNCTION: Lipid tetraspanin-associated transmembrane adapter/mediator that acts as a scaffold for Src-family kinases and other signaling proteins in immune cells (PubMed:21930792). It is involved in major histocompatibility complex class II (MHC-II) signaling transduction in B cells, where it is required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation (PubMed:21930792). In dendritic cells, it is involved in sustaining CLEC7A/DECTIN1 signaling after CLEC7A activation by fungal beta-glucans (By similarity). It also acts as an agonist-inducible signaling adapter for TLR1, TLR2, TLR3, TLR4, and TLR7 by selectively enabling the expression of pro-inflammatory cytokines IL6 and IL12B in macrophages and acting as a scaffold for phosphorylation of Toll-like receptors by Src-family kinases (By similarity). {ECO:0000250|UniProtKB:Q3UU41, ECO:0000269|PubMed:21930792}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level) (PubMed:21930792). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells (PubMed:21930792). Faintly expressed in the majority of nonimmune system tissues (PubMed:21930792). {ECO:0000269|PubMed:21930792}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |