Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens secretoglobin family 2A member 2 (SCGB2A2) (NM_002411). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q13296 |
| Entry Name | SG2A2_HUMAN |
| Gene Names | SCGB2A2 MGB1 UGB2 |
| Alternative Gene Names | MGB1 UGB2 |
| Alternative Protein Names | Mammaglobin-A (Mammaglobin-1) (Secretoglobin family 2A member 2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 93 |
| Molecular Weight(Da) | 10499 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF |
Background
| Function | |
| Pathway | |
| Protein Families | Secretoglobin family, Lipophilin subfamily |
| Tissue Specificity | Mammary gland specific. Over-expressed in breast cancer. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |