Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens secretoglobin family 2A member 1 (SCGB2A1) (NM_002407). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O75556 |
| Entry Name | SG2A1_HUMAN |
| Gene Names | SCGB2A1 LIPHC MGB2 UGB3 |
| Alternative Gene Names | LIPHC MGB2 UGB3 |
| Alternative Protein Names | Mammaglobin-B (Lacryglobin) (Lipophilin-C) (Mammaglobin-2) (Secretoglobin family 2A member 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 95 |
| Molecular Weight(Da) | 10884 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN |
Background
| Function | FUNCTION: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones. |
| Pathway | |
| Protein Families | Secretoglobin family, Lipophilin subfamily |
| Tissue Specificity | Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
