Recombinant Human SAT2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens spermidine/spermine N1-acetyltransferase family member 2 (SAT2), transcript variant 3 (NM_133491).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96F10
Entry Name SAT2_HUMAN
Gene Names SAT2 SSAT2
Alternative Gene Names SSAT2
Alternative Protein Names Thialysine N-epsilon-acetyltransferase (EC 2.3.1.-) (Diamine acetyltransferase 2) (EC 2.3.1.57) (Spermidine/spermine N(1)-acetyltransferase 2) (SSAT-2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 170
Molecular Weight(Da) 19155
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Background
Function FUNCTION: Catalyzes the N-acetylation of the amino acid thialysine (S-(2-aminoethyl)-L-cysteine), a L-lysine analog with the 4-methylene group substituted with a sulfur (PubMed:15283699). May also catalyze acetylation of polyamines, such as norspermidine, spermidine or spermine (PubMed:12803540). However, ability to acetylate polyamines is weak, suggesting that it does not act as a diamine acetyltransferase in vivo (PubMed:15283699). {ECO:0000269|PubMed:12803540, ECO:0000269|PubMed:15283699}.
Pathway
Protein Families Acetyltransferase family
Tissue Specificity Widely expressed (PubMed:15283699, PubMed:12803540). Under physiological conditions, SSAT2 is expressed at lower level that SSAT1 (SSAT). Many tissues express only SSAT1, several tissues express both SSAT1 and SSAT2, and bone, cervix, ovary and pineal gland expressed only SSAT2 (PubMed:12803540). {ECO:0000269|PubMed:12803540, ECO:0000269|PubMed:15283699}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8307805

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SAT2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.