Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial (Active)

Specification
Organism Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Expression Host Mammalian cell
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P59594
Uniprot Entry Name
Gene Names S
Alternative Names
Expression Region Extracellular domain (306-527aa)
Molecular Weight 30 kDa
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$356.00
In stock
SKU
EB-CMPHQE348788

Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SARS coronavirus Spike glycoprotein(S) ,partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.