Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Tag Info | N-terminal Flag-Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9Y467 |
Gene Names | SALL2 |
Alternative Names | Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2 |
Expression Region | Partial(1-198aa ) |
Molecular Weight | 25.3 kDa |
Protein Sequence | QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure. |
Involvement in Disease | Coloboma, ocular, autosomal recessive (COAR) |
Subcellular Location | Nucleus |
Protein Families | Sal C2H2-type zinc-finger protein family |
Tissue Specificity | SALL2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |