Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal Flag-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9Y467 |
| Gene Names | SALL2 |
| Alternative Names | Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2 |
| Expression Region | Partial(1-198aa ) |
| Molecular Weight | 25.3 kDa |
| Protein Sequence | QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure. |
| Involvement in Disease | Coloboma, ocular, autosomal recessive (COAR) |
| Subcellular Location | Nucleus |
| Protein Families | Sal C2H2-type zinc-finger protein family |
| Tissue Specificity | SALL2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |