Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens serum amyloid A1 (SAA1), transcript variant 1 (NM_000331). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P0DJI8 |
| Entry Name | SAA1_HUMAN |
| Gene Names | SAA1 |
| Alternative Gene Names | |
| Alternative Protein Names | Serum amyloid A-1 protein (SAA) [Cleaved into: Amyloid protein A (Amyloid fibril protein AA); Serum amyloid protein A(2-104); Serum amyloid protein A(3-104); Serum amyloid protein A(2-103); Serum amyloid protein A(2-102); Serum amyloid protein A(4-101)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 122 |
| Molecular Weight(Da) | 13532 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
Background
| Function | FUNCTION: Major acute phase protein. |
| Pathway | |
| Protein Families | SAA family |
| Tissue Specificity | Expressed by the liver; secreted in plasma (at protein level). {ECO:0000269|PubMed:12973732, ECO:0000269|PubMed:4816450, ECO:0000269|PubMed:7115671}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |