Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens S100 calcium binding protein A7 (S100A7) (NM_002963). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P31151 |
| Entry Name | S10A7_HUMAN |
| Gene Names | S100A7 PSOR1 S100A7C |
| Alternative Gene Names | PSOR1 S100A7C |
| Alternative Protein Names | Protein S100-A7 (Psoriasin) (S100 calcium-binding protein A7) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 101 |
| Molecular Weight(Da) | 11471 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
Background
| Function | |
| Pathway | |
| Protein Families | S-100 family |
| Tissue Specificity | Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients. {ECO:0000269|PubMed:8618345}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
