Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens S100 calcium binding protein A16 (S100A16), transcript variant 3 (NM_080388). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96FQ6 |
| Entry Name | S10AG_HUMAN |
| Gene Names | S100A16 S100F AAG13 |
| Alternative Gene Names | S100F |
| Alternative Protein Names | Protein S100-A16 (Aging-associated gene 13 protein) (Protein S100-F) (S100 calcium-binding protein A16) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 103 |
| Molecular Weight(Da) | 11801 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS |
Background
| Function | FUNCTION: Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity). {ECO:0000250|UniProtKB:Q9D708, ECO:0000269|PubMed:17030513}. |
| Pathway | |
| Protein Families | S-100 family |
| Tissue Specificity | Ubiquitous (PubMed:14684152). Highly expressed in esophagus, adipose tissues and colon. Expressed at lower level in lung, brain, pancreas and skeletal muscle. Expression is up-regulated in tumors of bladder, lung, thyroid gland, pancreas and ovary (PubMed:14684152). Expressed in astrocytes (PubMed:17030513). {ECO:0000269|PubMed:14684152, ECO:0000269|PubMed:17030513}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
