Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 1 (NM_001024210). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q99584 |
| Entry Name | S10AD_HUMAN |
| Gene Names | S100A13 |
| Alternative Gene Names | |
| Alternative Protein Names | Protein S100-A13 (S100 calcium-binding protein A13) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 98 |
| Molecular Weight(Da) | 11471 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
Background
| Function | FUNCTION: Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine (By similarity). {ECO:0000250, ECO:0000269|PubMed:12746488, ECO:0000269|PubMed:20863990}. |
| Pathway | |
| Protein Families | S-100 family |
| Tissue Specificity | Expressed in heart and skeletal muscle. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |