Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q15413 |
| Gene Names | RYR3 |
| Alternative Names | Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor |
| Expression Region | Partial(3934-4181aa ) |
| Molecular Weight | 32.5 kDa |
| Protein Sequence | DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication |
| Involvement in Disease | |
| Subcellular Location | Sarcoplasmic reticulum membrane, Multi-pass membrane protein, Membrane, Multi-pass membrane protein, Microsome membrane, Multi-pass membrane protein, Sarcoplasmic reticulum |
| Protein Families | Ryanodine receptor (TC 1.A.3.1) family, RYR3 subfamily |
| Tissue Specificity | RYR3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
