Recombinant Human RNASE9 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens ribonuclease A family member 9 (inactive) (RNASE9), transcript variant 7 (NM_001001673).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P60153
Entry Name RNAS9_HUMAN
Gene Names RNASE9
Alternative Gene Names
Alternative Protein Names Inactive ribonuclease-like protein 9
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 205
Molecular Weight(Da) 24307
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MMRTLITTHPLPLLLLPQQLLQLVQFQEVDTDFDFPEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGVYCNLTEAFEIPACKYESLYRKGYVLITCSWQNEMQKRIPHTINDLVEPPEHRSFLSEDGVFVISP
Background
Function FUNCTION: Does not exhibit any ribonuclease activity. {ECO:0000269|PubMed:18992174, ECO:0000269|PubMed:19137000}.
Pathway
Protein Families Pancreatic ribonuclease family
Tissue Specificity At the mRNA level, widely expressed (PubMed:18992174). At protein level, restricted to epididymis (PubMed:19137000). Expressed in spermatozoa (sperm head and neck), with higher levels on ejaculated and epididymal sperm than on testicular sperm (at protein level). Expressed in the epithelial cells of the epididymal tubule (at protein level). Not detected in muscle. {ECO:0000269|PubMed:18992174, ECO:0000269|PubMed:19137000}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8533982

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RNASE9 protein
Copyright © 2026-present Echo Bio. All rights reserved.