Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens relaxin 3 (RLN3), transcript variant 1 (NM_080864). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WXF3 |
| Entry Name | REL3_HUMAN |
| Gene Names | RLN3 INSL7 RXN3 ZINS4 UNQ6188/PRO20213 |
| Alternative Gene Names | INSL7 RXN3 ZINS4 |
| Alternative Protein Names | Relaxin-3 (Insulin-like peptide INSL7) (Insulin-like peptide 7) (Prorelaxin H3) [Cleaved into: Relaxin-3 B chain; Relaxin-3 A chain] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 142 |
| Molecular Weight(Da) | 15451 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC |
Background
| Function | FUNCTION: May play a role in neuropeptide signaling processes. Ligand for LGR7, RXFP3 and RXFP4. |
| Pathway | |
| Protein Families | Insulin family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
