Recombinant Human RIPPLY3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ripply transcriptional repressor 3 (RIPPLY3), transcript variant 1 (NM_018962).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P57055
Entry Name DSCR6_HUMAN
Gene Names RIPPLY3 DSCR6
Alternative Gene Names DSCR6
Alternative Protein Names Protein ripply3 (Down syndrome critical region protein 6)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 190
Molecular Weight(Da) 20368
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
Background
Function FUNCTION: Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity). {ECO:0000250}.
Pathway
Protein Families Ripply family
Tissue Specificity Expressed at a low level in fetal kidney and fetal brain. {ECO:0000269|PubMed:10814524}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8051635

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RIPPLY3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.