Recombinant Human RING finger protein 11(RNF11)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info C-terminal 9xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9Y3C5
Gene Names RNF11
Alternative Names CGI 123; RING finger protein 11; RNF11; RNF11_HUMAN; Sid 1669; SID1669
Expression Region Full Length of Mature Protein(2-154aa )
Molecular Weight 19.3 kDa
Protein Sequence GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.
Involvement in Disease
Subcellular Location Early endosome, Recycling endosome, Cytoplasm, Nucleus
Protein Families
Tissue Specificity RNF11
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PB6HU19941

Recombinant Human RING finger protein 11(RNF11)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RING finger protein 11(RNF11)
Copyright © 2021-present Echo Biosystems. All rights reserved.