Recombinant Human RILPL2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens Rab interacting lysosomal protein like 2 (RILPL2), transcript variant 1 (NM_145058).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q969X0
Entry Name RIPL2_HUMAN
Gene Names RILPL2 RLP2
Alternative Gene Names RLP2
Alternative Protein Names RILP-like protein 2 (Rab-interacting lysosomal protein-like 2) (p40phox-binding protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 211
Molecular Weight(Da) 23986
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT
Background
Function FUNCTION: Involved in cell shape and neuronal morphogenesis, positively regulating the establishment and maintenance of dendritic spines (By similarity). Plays a role in cellular protein transport, including protein transport away from primary cilia (By similarity). May function via activation of RAC1 and PAK1 (By similarity). {ECO:0000250|UniProtKB:Q6AYA0, ECO:0000250|UniProtKB:Q99LE1}.
Pathway
Protein Families RILPL family
Tissue Specificity Widely expressed. Expressed at higher level in lung. {ECO:0000269|PubMed:14668488}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8431015

Recombinant Human RILPL2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RILPL2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.