Recombinant Human Ribonuclease 4(RNASE4)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P34096
Gene Names RNASE4
Alternative Names RNS4
Expression Region Full Length of Mature Protein(29-147aa )
Molecular Weight 17.8 kDa
Protein Sequence QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This RNase has marked specificity towards the 3' side of uridine nucleotides.
Involvement in Disease
Subcellular Location Secreted
Protein Families Pancreatic ribonuclease family
Tissue Specificity RNASE4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PBUb1198086

Recombinant Human Ribonuclease 4(RNASE4)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Ribonuclease 4(RNASE4)
Copyright © 2021-present Echo Biosystems. All rights reserved.