Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25800 |
| Gene Names | LMO1 |
| Alternative Names | Cysteine-rich protein TTG-1LIM domain only protein 1 ;LMO-1T-cell translocation protein 1 |
| Expression Region | Partial(5-156aa ) |
| Molecular Weight | 44.4 kDa |
| Protein Sequence | DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. |
| Involvement in Disease | A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD. |
| Subcellular Location | Nucleus |
| Protein Families | |
| Tissue Specificity | LMO1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |