Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P52565 |
| Gene Names | ARHGDIA |
| Alternative Names | Rho-GDI alpha |
| Expression Region | Full Length of Mature Protein(2-204aa ) |
| Molecular Weight | 50.1 kDa |
| Protein Sequence | AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting th from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from mbranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SA5A and PLXNB3 that lead to inactivation of RAC1. |
| Involvement in Disease | Nephrotic syndrome 8 (NPHS8) |
| Subcellular Location | Cytoplasm |
| Protein Families | Rho GDI family |
| Tissue Specificity | ARHGDIA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
