Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens resistin (RETN), transcript variant 1 (NM_020415). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9HD89 |
| Entry Name | RETN_HUMAN |
| Gene Names | RETN FIZZ3 HXCP1 RSTN UNQ407/PRO1199 |
| Alternative Gene Names | FIZZ3 HXCP1 RSTN |
| Alternative Protein Names | Resistin (Adipose tissue-specific secretory factor) (ADSF) (C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein) (Cysteine-rich secreted protein A12-alpha-like 2) (Cysteine-rich secreted protein FIZZ3) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 108 |
| Molecular Weight(Da) | 11419 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Background
| Function | FUNCTION: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells (PubMed:15064728). {ECO:0000250|UniProtKB:Q99P87, ECO:0000269|PubMed:15064728}. |
| Pathway | |
| Protein Families | Resistin/FIZZ family |
| Tissue Specificity | Expressed in white adipose tissue (at protein level) (PubMed:11201732). Widely expressed, with particularly strong expression in lung, bone marrow, breast and peripheral blood (PubMed:15248836). Expressed strongly in bone marrow and at lower levels in lung, but not detected in other tissues (PubMed:15064728). Isoform 2 is detected in adipose tissue, bone marrow, brain, lung, peripheral blood, placenta and thymus (PubMed:15248836). {ECO:0000269|PubMed:11201732, ECO:0000269|PubMed:15064728, ECO:0000269|PubMed:15248836}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |