Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8TC12 |
| Gene Names | RDH11 |
| Alternative Names | Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12;Prostate short-chain dehydrogenase/reductase 1Retinal reductase 1 ;RalR1Short chain dehydrogenase/reductase family 7C member 1 |
| Expression Region | Cytoplasmic Domain(22-318aa ) |
| Molecular Weight | 49 kDa |
| Protein Sequence | PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. |
| Involvement in Disease | Retinal dystrophy, juvenile cataracts, and short stature syndrome (RDJCSS) |
| Subcellular Location | Endoplasmic reticulum membrane, Single-pass type II membrane protein |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Tissue Specificity | RDH11 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
