Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O15539 |
| Gene Names | RGS5 |
| Alternative Names | MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5; RGS5_HUMAN |
| Expression Region | Full Length(1-181aa ) |
| Molecular Weight | 47.9 kDa |
| Protein Sequence | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha |
| Involvement in Disease | |
| Subcellular Location | Isoform 1: Cytoplasm, Membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm |
| Protein Families | |
| Tissue Specificity | RGS5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |