Recombinant Human Recoverin(RCVRN)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P35243
Gene Names RCVRN
Alternative Names Cancer-associated retinopathy protein (Protein CAR) (RCV1)
Expression Region Full Length of Mature Protein(2-200aa )
Molecular Weight 27.0 kDa
Protein Sequence GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Involvement in Disease
Subcellular Location
Protein Families Recoverin family
Tissue Specificity RCVRN
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$531.00
In stock
SKU
EB-PM9HU19644

Recombinant Human Recoverin(RCVRN)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Recoverin(RCVRN)
Copyright © 2021-present Echo Biosystems. All rights reserved.