Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O00559 |
Gene Names | EBAG9 |
Alternative Names | Cancer-associated surface antigen R;CAS1;Estrogen receptor-binding fragment-associated gene 9 protein |
Expression Region | Cytoplasmic Domain(28-213aa ) |
Molecular Weight | 37.2 kDa |
Protein Sequence | RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases. |
Involvement in Disease | |
Subcellular Location | Golgi apparatus membrane, Single-pass type III membrane protein |
Protein Families | |
Tissue Specificity | EBAG9 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |