Recombinant Human RBBP7 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens RB binding protein 7, chromatin remodeling factor (RBBP7), transcript variant 2 (NM_002893).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q16576
Entry Name RBBP7_HUMAN
Gene Names RBBP7 RBAP46
Alternative Gene Names RBAP46
Alternative Protein Names Histone-binding protein RBBP7 (Histone acetyltransferase type B subunit 2) (Nucleosome-remodeling factor subunit RBAP46) (Retinoblastoma-binding protein 7) (RBBP-7) (Retinoblastoma-binding protein p46)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 425
Molecular Weight(Da) 47820
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS
Background
Function FUNCTION: Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex. {ECO:0000269|PubMed:10866654}.
Pathway
Protein Families WD repeat RBAP46/RBAP48/MSI1 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8025697

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RBBP7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.