Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q5JS13 |
| Gene Names | RALGPS1 |
| Alternative Names | Ral GEF with PH domain and SH3-binding motif 1Ral guanine nucleotide exchange factor 2 ;RalGEF 2RalA exchange factor RalGPS1 |
| Expression Region | Full Length of Isoform 4(1-305aa ) |
| Molecular Weight | 50.7 kDa |
| Protein Sequence | MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization . Guanine nucleotide exchange factor for. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Cell membrane |
| Protein Families | |
| Tissue Specificity | RALGPS1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |