Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P20339 |
| Gene Names | RAB5A |
| Alternative Names | RAB 5; RAB 5A; RAB5A; RAB5A member RAS oncogene family; RAB5A_HUMAN; RAS associated protein RAB5A; Ras related protein Rab 5A; Ras-related protein Rab-5A |
| Expression Region | Full Length(1-215aa ) |
| Molecular Weight | 39.7 kDa |
| Protein Sequence | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB5A is required for the fusion of plasma mbranes and early endosomes. Contributes to the regulation of filopodia extension. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome, Cytoplasmic vesicle, Cell projection, ruffle, Membrane, Cytoplasm, cytosol, Cytoplasmic vesicle, phagosome membrane, Endosome membrane |
| Protein Families | Small GTPase superfamily, Rab family |
| Tissue Specificity | RAB5A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |