Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P20338 |
| Gene Names | RAB4A |
| Alternative Names | HRES 1 / RAB4; Oncogene RAB4; Rab 4; RAB 4A; RAB4 member RAS oncogene family; Rab4a; RAB4A member RAS oncogene family; RAB4A_HUMAN; Ras related protein Rab 4A; Ras related protein Rab4A; Ras-related protein Rab-4A |
| Expression Region | Full Length(1-218aa ) |
| Molecular Weight | 51.4 kDa |
| Protein Sequence | MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Protein transport. Probably involved in vesicular traffic . |
| Involvement in Disease | |
| Subcellular Location | Membrane, Peripheral membrane protein, Cytoplasm, Early endosome membrane, Peripheral membrane protein, Recycling endosome membrane, Peripheral membrane protein |
| Protein Families | Small GTPase superfamily, Rab family |
| Tissue Specificity | RAB4A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |