Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9ULC3 |
| Gene Names | RAB23 |
| Alternative Names | DKFZp781H0695; HSPC137; MGC8900; Rab 23; RAB family small GTP binding protein RAB 23; Rab23; RAB23; member RAS oncogene family; RAB23_HUMAN; Ras related protein Rab 23; Ras-related protein Rab-23 |
| Expression Region | Full Length(1-237aa ) |
| Molecular Weight | 53.7 kDa |
| Protein Sequence | MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Together with SUFU, prevents nuclear import of GLI1, and thereby inhibits GLI1 transcription factor activity. Regulates GLI1 in differentiating chondrocytes. Likewise, regulates GLI3 proteolytic processing and modulates GLI2 and GLI3 transcription factor activity. Plays a role in autophagic vacuole assembly, and mediates defense against pathogens, such as S.aureus, by promoting their capture by autophagosomes that then merge with lysosomes. |
| Involvement in Disease | Carpenter syndrome 1 (CRPT1) |
| Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, Cytoplasmic vesicle, autophagosome, Endosome membrane, Cytoplasmic vesicle, phagosome, Cytoplasmic vesicle, phagosome membrane, Lipid-anchor, Cytoplasmic side |
| Protein Families | Small GTPase superfamily, Rab family |
| Tissue Specificity | RAB23 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |