Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P62820 |
| Gene Names | RAB1A |
| Alternative Names | YPT1-related protein |
| Expression Region | Full Length of Mature Protein(2-205aa ) |
| Molecular Weight | 49.5 kDa |
| Protein Sequence | SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The small GTPases Rab are key regulators of intracellular mbrane trafficking, from the formation of transport vesicles to their fusion with mbranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to mbranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell mbrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assbly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. |
| Involvement in Disease | |
| Subcellular Location | Golgi apparatus, Endoplasmic reticulum, Early endosome, Cytoplasm, cytosol, Membrane, Melanosome |
| Protein Families | Small GTPase superfamily, Rab family |
| Tissue Specificity | RAB1A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |