Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9NP72 |
| Gene Names | RAB18 |
| Alternative Names | AA959686; RAB18; RAB18 small GTPase; RAB18; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3 |
| Expression Region | Full Length(1-206aa ) |
| Molecular Weight | 49.7 kDa |
| Protein Sequence | MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration. |
| Involvement in Disease | Warburg micro syndrome 3 (WARBM3) |
| Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side |
| Protein Families | Small GTPase superfamily, Rab family |
| Tissue Specificity | RAB18 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |