Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens RAB interacting factor (RABIF) (NM_002871). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P47224 |
| Entry Name | MSS4_HUMAN |
| Gene Names | RABIF MSS4 RASGRF3 |
| Alternative Gene Names | MSS4 RASGRF3 |
| Alternative Protein Names | Guanine nucleotide exchange factor MSS4 (Rab-interacting factor) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 123 |
| Molecular Weight(Da) | 13839 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE |
Background
| Function | FUNCTION: Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1, RAB3A and RAB10, but is less active on these proteins than on the SEC4 protein (PubMed:31540829). Might play a general role in vesicular transport. {ECO:0000269|PubMed:31540829}. |
| Pathway | |
| Protein Families | DSS4/MSS4 family |
| Tissue Specificity | Ubiquitous. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |