Recombinant Human RAB9B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens RAB9B, member RAS oncogene family (RAB9B), transcript variant 1 (NM_016370).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NP90
Entry Name RAB9B_HUMAN
Gene Names RAB9B RAB9L
Alternative Gene Names RAB9L
Alternative Protein Names Ras-related protein Rab-9B (Rab-9-like protein) (Rab-9L)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 201
Molecular Weight(Da) 22719
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC
Background
Function FUNCTION: Involved in the transport of proteins between the endosomes and the trans Golgi network. {ECO:0000250|UniProtKB:P24408}.
Pathway
Protein Families Small GTPase superfamily, Rab family
Tissue Specificity Ubiquitous. {ECO:0000269|PubMed:11043518}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8412975

Recombinant Human RAB9B protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RAB9B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.