Recombinant Human RAB4A protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens RAB4A, member RAS oncogene family (RAB4A), transcript variant 1 (NM_004578).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P20338
Entry Name RAB4A_HUMAN
Gene Names RAB4A RAB4
Alternative Gene Names RAB4
Alternative Protein Names Ras-related protein Rab-4A (EC 3.6.5.2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 218
Molecular Weight(Da) 24390
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Background
Function FUNCTION: Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state (PubMed:15907487, PubMed:16034420). Involved in protein transport (PubMed:29425100). Plays a role in vesicular traffic. Mediates VEGFR2 endosomal trafficking to enhance VEGFR2 signaling (PubMed:29425100). Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets (By similarity). {ECO:0000250|UniProtKB:P56371, ECO:0000269|PubMed:15907487, ECO:0000269|PubMed:16034420, ECO:0000269|PubMed:29425100}.
Pathway
Protein Families Small GTPase superfamily, Rab family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8248135

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RAB4A protein
Copyright © 2021-present Echo Biosystems. All rights reserved.