Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P98179 |
Gene Names | RBM3 |
Alternative Names | RNA-binding motif protein 3RNPL |
Expression Region | Full Length(1-157aa ) |
Molecular Weight | 33.2 kDa |
Protein Sequence | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic tperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation . |
Involvement in Disease | |
Subcellular Location | Nucleus, Cytoplasm, Cell projection, dendrite |
Protein Families | |
Tissue Specificity | RBM3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |