Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P11686 |
Gene Names | SFTPC |
Alternative Names | Pulmonary surfactant-associated proteolipid SPL(Val)SP5 |
Expression Region | Full Length of Mature Protein(24-58aa ) |
Molecular Weight | 5.7 kDa |
Protein Sequence | FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. |
Involvement in Disease | Pulmonary surfactant metabolism dysfunction 2 (SMDP2); Respiratory distress syndrome in premature infants (RDS) |
Subcellular Location | Secreted, extracellular space, surface film |
Protein Families | |
Tissue Specificity | SFTPC |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |