Specification
Organism | Homo sapiens (Human) |
Expression Host | in vitro E.coli expression system |
Tag Info | N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q8IWL2 |
Gene Names | SFTPA1 |
Alternative Names | Collectin-4 |
Expression Region | Full Length of Mature Protein(21-248aa ) |
Molecular Weight | 41.2 kDa |
Protein Sequence | EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. |
Involvement in Disease | Pulmonary fibrosis, idiopathic (IPF); Respiratory distress syndrome in premature infants (RDS) |
Subcellular Location | Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film |
Protein Families | SFTPA family |
Tissue Specificity | SFTPA1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |