Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens parathyroid hormone 2 (PTH2) (NM_178449). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96A98 |
| Entry Name | TIP39_HUMAN |
| Gene Names | PTH2 TIP39 TIPF39 |
| Alternative Gene Names | TIP39 TIPF39 |
| Alternative Protein Names | Tuberoinfundibular peptide of 39 residues (TIP39) (Parathyroid hormone 2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 100 |
| Molecular Weight(Da) | 11202 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Background
| Function | FUNCTION: Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits. {ECO:0000269|PubMed:11861531, ECO:0000269|PubMed:12559132, ECO:0000269|PubMed:12754053, ECO:0000269|PubMed:14988434}. |
| Pathway | |
| Protein Families | Parathyroid hormone family |
| Tissue Specificity | Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. {ECO:0000269|PubMed:12098667}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |