Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P61457 |
| Gene Names | PCBD1 |
| Alternative Names | 4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha Short name: DCoH Short name: Dimerization cofactor of HNF1 Phenylalanine hydroxylase-stimulating protein Pterin carbinolamine dehydratase DCOH, PCBD |
| Expression Region | Full Length of Mature Protein(2-104aa ) |
| Molecular Weight | 15.9 kDa |
| Protein Sequence | AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. |
| Involvement in Disease | Hyperphenylalaninemia, BH4-deficient, D (HPABH4D) |
| Subcellular Location | Cytoplasm, Nucleus |
| Protein Families | Pterin-4-alpha-carbinolamine dehydratase family |
| Tissue Specificity | PCBD1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |