Recombinant Human PRXL2C protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens peroxiredoxin like 2C (PRXL2C) (NM_153698).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q7RTV5
Entry Name PXL2C_HUMAN
Gene Names PRXL2C AAED1 C9orf21
Alternative Gene Names AAED1 C9orf21
Alternative Protein Names Peroxiredoxin-like 2C (AhpC/TSA antioxidant enzyme domain-containing protein 1) (Thioredoxin-like protein AAED1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 226
Molecular Weight(Da) 24857
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV
Background
Function FUNCTION: May regulate positively ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis. {ECO:0000269|PubMed:29901208}.
Pathway
Protein Families Peroxiredoxin-like PRXL2 family, PRXL2C subfamily
Tissue Specificity Expressed in gastric tissues. {ECO:0000269|PubMed:29901208}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8072045

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PRXL2C protein
Copyright © 2026-present Echo Bio. All rights reserved.