Recombinant Human Prothymosin alpha(PTMA)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06454
Gene Names PTMA
Alternative Names TMSA
Expression Region Full Length(1-111aa )
Molecular Weight 14.7 kDa
Protein Sequence MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Involvement in Disease
Subcellular Location Nucleus
Protein Families Pro/parathymosin family
Tissue Specificity PTMA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PYUb0190125

Recombinant Human Prothymosin alpha(PTMA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Prothymosin alpha(PTMA)
Copyright © 2021-present Echo Biosystems. All rights reserved.