Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Baculovirus |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P56706 |
| Gene Names | WNT7B |
| Alternative Names | Protein Wnt-7b; Wingless related MMTV integration site 7B; Wingless type MMTV integration site family member 7B; WNT; WNT7B; WNT7B_HUMAN |
| Expression Region | Full Length of Mature Protein(25-349aa ) |
| Molecular Weight | 40.2 kDa |
| Protein Sequence | ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt/beta-catenin signaling pathway in vascular smooth muscle cells. Required for normal fusion of the chorion and the allantois during placenta development. |
| Involvement in Disease | |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Wnt family |
| Tissue Specificity | WNT7B |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |