Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P60903 |
| Gene Names | S100A10 |
| Alternative Names | Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11 |
| Expression Region | Full Length(1-97aa ) |
| Molecular Weight | 18.2 kDa |
| Protein Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | S-100 family |
| Tissue Specificity | S100A10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |