Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q96PU8 |
| Gene Names | QKI |
| Alternative Names | DKFZp586I0923; HKQ; Homolog of mouse quaking QKI KH domain RNA binding protein; Hqk; HQK1; HqkI; OTTHUMP00000017581; OTTHUMP00000017582; OTTHUMP00000017583; Protein quaking; QK; QK1; QK3; QKI; QKI_HUMAN; QKI1; Quaking homolog; Quaking homolog KH domain RNA binding; Quaking homolog KH domain RNA binding mouse; Quaking isoform 1; Quaking protein; RNA binding protein HQK |
| Expression Region | Full Length(1-341aa ) |
| Molecular Weight | 64.7 kDa |
| Protein Sequence | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor . |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Cytoplasm |
| Protein Families | |
| Tissue Specificity | QKI |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
