Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q86TP1 |
| Gene Names | PRUNE |
| Alternative Names | Drosophila-related expressed sequence 17 ;DRES-17 ;DRES17HTcD37 |
| Expression Region | Full Length of Isoform 6(1-168aa ) |
| Molecular Weight | 22.5 kDa |
| Protein Sequence | MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1. |
| Involvement in Disease | Neurodevelopmental disorder with microcephaly, hypotonia, and variable brain anomalies (NMIHBA) |
| Subcellular Location | Cytoplasm, Nucleus, Cell junction, focal adhesion |
| Protein Families | PPase class C family, Prune subfamily |
| Tissue Specificity | PRUNE |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |